PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG008214t4
Common NameTCM_008214
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HB-other
Protein Properties Length: 1641aa    MW: 184571 Da    PI: 4.9063
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG008214t4genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox36.21.1e-112352457
                      S--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox 24 ypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      yps+++r+eL+ +lgL++rq ++WF+ rR k++k
  Thecc1EG008214t4  2 YPSEATRAELSVQLGLSDRQLQMWFCHRRLKDRK 35
                      9*******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.135136IPR001356Homeobox domain
CDDcd000862.28E-8135No hitNo description
SuperFamilySSF466891.67E-8237IPR009057Homeodomain-like
PfamPF000463.4E-9235IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.1E-10235IPR009057Homeodomain-like
PROSITE profilePS5082716.82503562IPR018501DDT domain
SMARTSM005714.6E-22503562IPR018501DDT domain
PfamPF027912.2E-16504559IPR018501DDT domain
PfamPF050661.3E-15685753IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.0E-7904945IPR028942WHIM1 domain
PfamPF156131.3E-1310861158IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1641 aa     Download sequence    Send to blast
MYPSEATRAE LSVQLGLSDR QLQMWFCHRR LKDRKAPPVK RRRKDSSLPA QVVGVAGEEM  60
GGGEAENEHG SDVSSLFGPG LHLRRAVPIP GMAVPRYYEM THSMAELELR AITFVELQLG  120
EPIRDDGPML GMEFDPLPPG AFGAPIGAST AVQQKQPGQP FETKIYERLD TKAVKGSVRA  180
VHEYQFLPEQ PSVRTETYER VALSYHYGSP TDDPHARASS LSTGCSFVHG NEKVPSGYGF  240
SGQMPNLNLL PQQSRQGHLL PTASGEYDNC SRKNSLTNTT VDAIIGAHPI SALESPFVSS  300
DRRVNLDEDA LRMERKRKSE EARIAREVEA HEKRIRKELE KQDILRRKRE EQIRKEMERH  360
DRERRKEEER LLREKQREEE RYQREQRREL ERREKFLMKE SIRAERMRQK EELRKEKEAA  420
RLKAANERAI ARKLAKESME LIEDERLELM ELAASSKGLS STLSLDFEIL QNLDIFRDKL  480
CVFPPKGVQL KRSFSIEPWN SSEESIGNLL MVWRFLITFA DVVGLWPFTL DELVQAFHDY  540
DPRLLGEIHV ALLRSIIKDI EDVARTPSTG LGASQNNAAN PGGGHLQIVE GAYAWGFDIR  600
SWQGHLNMLT WPEILRQFAL SAGFGPQLKK RNIEQAYLRD ENEGNDGEDI ITNLRNGAAA  660
ENAVAIMQER GFSNPRRSRH RLTPGTVKFA AFHVLSLEDS DGLTILEVAE KIQKSGLRDL  720
TTSKTPEASI AAALSRDTKL FERTAPSTYC VRSPYRKDPA DAEAILSAAR ERIRVLKSGF  780
VGEDAEGAER DEDSESDIAE DLEVDDLGAE INPKKEMLNS EGSSSCDAKT ILGNEKEICE  840
ILETPQGEVR NVCKALSSPT AGGLDEVKYI DAPVEQSMDA AGICNGAANA GLEDTEIDES  900
KLGEPWVQGL MEGDYSDLSV EERLNALIAL ISIAIEGNSI RVVLEERLEA ANALKKQMWA  960
EAQLDKRRMK EEFVLRTNFS SHMGNKMEPS LMMSSAECRQ SPQIISDRKN NESSVDLVVQ  1020
QECLNNPQND QNYLNNVPSE GNMPIQDFSI GPDNLQYPQP GCAAERSRSQ LKSYIGHKAE  1080
EMYVYRSLPL GQDRRHNRYW RFITSASWND PGCGRIFVEL LDGRWRLIDT EEGFDTLLSS  1140
LDVRGVRESH LHAMLQKIEM SFKEAVRRNK LHVNMERQNG DTIKKEANEM ASGPDWNVSF  1200
ESPSSTVSGS DSDMSETSTS FSIELCRNEI EKNDALKRYR DFEKWMWKEC FSLSSFCATK  1260
YGRRRCKQLL GVCDSCFNIY FFEDNHCPSC HRTDIASRSM LNFSEHVAQC AKKLQLGPGF  1320
ALDGLVISPL RIRLTKLQLA LVEVSIPFEA LQSAWTEGYR NFWGMKLYSS TTAEELLQVL  1380
TLLESSITRD YLSSNFETTR ELLSPSILSG GVGDDSTNLE TVPVLPWIPK TTAAVALRLI  1440
EFDAAISYTL KQRAETHKGA GECMGRGGRK RGRRSARSRP KPAKRMVEIA GERENPKEIM  1500
EKSSRNLATN TWNGDEVTRL KVRTADNASS SERSEYNDEN GQATGDEYDY LAGEDYAGGF  1560
NGKADDVMEG SEYNIDGDED DDGEERDDIA EGEQGNFIVG GYINENSDEE EIRNGDDPED  1620
SDPYVKQYGY STEASSDFSE *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007043694.10.0Homeodomain-like transcriptional regulator, putative isoform 4
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A061E3I60.0A0A061E3I6_THECC; Homeodomain-like transcriptional regulator, putative isoform 4
STRINGPOPTR_0007s01330.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]